A practical reference on lyophilized powder: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2026-03-01. Anything still debated is marked as such rather than presented as settled.
Researchers have studied the fragment in cell and animal models to understand its metabolic actions. Some experiments report effects on fat breakdown and fat storage pathways, but the underlying mechanism remains incompletely defined. AOD-9604 does not appear to stimulate the same broad growth hormone receptor signaling as full-length hGH. Whether its observed activities arise from direct receptor interactions or downstream metabolic changes is an open question. Results from different assays are not always consistent.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to residues 176-191 of the 191-amino-acid hGH sequence. The fragment is not the full hormone and lacks the receptor-binding region associated with growth and metabolic effects of hGH. Researchers developed it to isolate a specific portion of hGH for study. Its exact sequence and length are often stated in peptide catalogs and patents.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
AOD-9604 is listed as a prohibited substance in sport by the World Anti-Doping Agency. It falls under the peptide hormones, growth factors, related substances, and mimetics class on the prohibited list. Anti-doping organizations treat its presence in an athlete's sample as an adverse finding unless a therapeutic use exemption applies. The prohibition reflects concerns about performance enhancement in competitive settings and the difficulty of distinguishing exogenous peptide use from endogenous hormone fragments.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Derived from a fragment of human growth hormone |
| Sequence basis | hGH residues 176-191 | Commonly described as a 16-amino-acid fragment |
| Appearance | White to off-white powder | Typical for lyophilized research peptides |
| Solubility | Soluble in water or aqueous buffer | Exact solubility depends on pH and purity |
| Common synonyms | AOD9604; hGH 176-191 | Spelling and punctuation vary across sources |
Regulatory status varies by country. In the United States, AOD-9604 is not approved as a prescription drug. It is sometimes sold as a research chemical or dietary supplement, though such marketing may fall outside legal frameworks. The World Anti-Doping Agency prohibits its use in sport. Researchers must obtain it through legitimate suppliers and follow institutional rules. Its legal classification continues to evolve as authorities increasingly assess peptide products more broadly.
AOD-9604 is a synthetic peptide whose sequence matches the C-terminal fragment of human growth hormone, specifically residues 176 through 191. This region differs from the full hormone in its receptor interactions. The peptide is not a growth hormone secretagogue and does not bind the growth hormone receptor in the same manner. Researchers have examined it for effects on lipid metabolism, but its exact pharmacological profile remains an active area of study.
Development of AOD-9604 began in the 1990s as scientists sought to isolate metabolic effects of growth hormone without its growth-promoting actions. Early laboratory work focused on fat cells and animal models. Several human trials followed, examining changes in body composition and fat mass. Results have been mixed, and the peptide has not progressed to widespread clinical approval. Interest continues in research settings, particularly regarding its mechanism and potential metabolic targets.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
AOD-9604 has been investigated primarily as a potential treatment for obesity and related metabolic conditions. Early laboratory work examined its effects on fat cells, and later studies moved into animal models and human clinical trials. Some trials reportedly reached Phase II, but the program did not lead to an approved medicine. Published summaries often note that weight-loss results were modest or inconsistent. The full trial data are not all publicly available in detail.
Regulatory treatment of AOD-9604 has varied. In sports anti-doping, the peptide became widely discussed during a 2013 investigation into an Australian professional sports club. Authorities at the time debated whether it fell under prohibitions on growth hormone and related substances. Later clarifications and updated lists have addressed the compound in different ways. Anyone seeking current status should consult the latest applicable rules, and commercial supply for human use is not authorized in major markets.
Early interest in AOD-9604 centered on whether a fragment of human growth hormone could influence fat metabolism without the broader effects of the full hormone. Cell and animal studies reported changes in fat storage and breakdown. Human trials followed, but the results were not strong enough to secure regulatory approval. The compound remains available for laboratory research, and its clinical potential is still described as uncertain. Studies continue to examine its activity and safety profile.
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
Several names appear in scientific and commercial settings. AOD9604 and AOD-9604 are development codes used interchangeably, while hGH fragment 176-191 describes the same region. The peptide includes a disulfide bond between two cysteine residues, which helps shape its three-dimensional structure. Different suppliers may provide acetate or other salt forms, and purity can vary. These differences matter because analytical tests and biological assays can respond to the specific form being studied.
Stability of AOD-9604 depends on storage conditions. Lyophilized powder is generally more stable than reconstituted solution. Recommended storage is typically at -20°C or lower, protected from light and moisture. Repeated freeze-thaw cycles can cause aggregation or degradation. In solution, the peptide may be susceptible to hydrolysis or oxidation, so aliquoting and cold storage are common practices. Researchers often add stabilizers such as mannitol or trehalose during lyophilization to improve shelf life.
Quality control for AOD-9604 involves verifying identity, purity, and concentration. Suppliers may provide a certificate of analysis listing HPLC purity and mass spectrometry data. Independent verification is advised because peptide products can vary in quality. Researchers should check for counterions, residual solvents, and microbial contamination. Proper documentation supports reproducibility and safety in laboratory studies. When sourcing, institutions often require third-party testing and detailed chain-of-custody records. These steps help ensure that experimental results are attributable to the peptide rather than impurities.
Analytical characterization of AOD-9604 typically employs reversed-phase high-performance liquid chromatography (RP-HPLC) to assess purity and identity. Mass spectrometry provides confirmation of molecular mass, while amino acid analysis can verify composition. These methods are standard for peptide research chemicals. Because the peptide lacks a distinct chromophore, detection often relies on ultraviolet absorbance at 214 nm or mass spectrometric response. Laboratories may also use capillary electrophoresis for separation. For example, size-exclusion chromatography can detect aggregates.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
After replication of the desired region, the RNA primer is removed by DNA polymerase I via the process of nick translation. The removal of the RNA primer allows DNA ligase to ligate the DNA-DNA nick between the new fragment and the previous strand. DNA polymerase I & III, along with many other enzymes are all required for the high fidelity, high-processivity of DNA replication. Beta clamp DNA polymerase DNA replication Overview at Oregon State University DNA+Polymerase+III at the U.S. National Library of Medicine Medical Subject Headings (MeSH) Clamping down on pathogenic bacteria[link removed] – how to shut down a key DNA polymerase complex
Aminosalicylic acid was introduced to clinical use in 1944. It was the second antibiotic found to be effective in the treatment of tuberculosis, after streptomycin. PAS formed part of the standard treatment for tuberculosis prior to the introduction of rifampicin and pyrazinamide. Its potency is less than that of the current five first-line drugs (isoniazid, rifampicin, ethambutol, pyrazinamide, and streptomycin) for treating tuberculosis and its cost is higher, but it is still useful in the treatment of multidrug-resistant tuberculosis. PAS is always used in combination with other anti-TB drugs. 4-Aminosalicylic acid has also been used in the treatment of inflammatory bowel disease (ulcerative colitis and Crohn's disease), but has been superseded by other drugs such as sulfasalazine and mesalazine. 4-Aminosalicylic acid has been investigated for the use in manganese chelation therapy, and a 17-year follow-up study shows that it might be superior to other chelation protocols such as EDTA.
An analytical ultracentrifuge has a light source and optical detectors. To allow the light to pass through the analyte during the ultracentrifuge run, specialized cells are required which have to meet high optical standards as well as to resist the centrifugal forces. Each cell consists of a housing, two windows made from optically pure quartz glass, and a centrepiece with one or two sectors and filling holes for the sector(s), closed with a screw plug in the housing. These cell are placed into a rotor cavity with a continuous bore, with a collar at the bottom to retain the cell. By applying specific equipment and adapting measurement parameters several types of experiments can be performed. Most common AUC experiments are sedimentation velocity and sedimentation equilibrium experiments.
3 cos Ω = 1 − 4 cos2 φ + ψ/2 The α-helix is tightly packed; there is almost no free space within the helix. The amino-acid side-chains are on the outside of the helix, and point roughly "downward" (i.e., toward the N-terminus), like the branches of an evergreen tree (Christmas tree effect). This directionality is sometimes used in preliminary, low-resolution electron-density maps to determine the direction of the protein backbone.
Sources: en.wikipedia.org
The Edman degradation is an alternative method for peptide sequencing that cleaves amino acid residues from the N-terminus of a peptide. In 1950 Edman designed a reaction with phenylthiocyanate (the idea for which was borrowed from a 1927 study by Bergmann, Kann and Miekeley ) to give phenylthiocarbamyl peptides followed by hydrolysis under relatively mild conditions to cleave N-terminal amino acid as phenylthiohydantoin. Phenylthiohydantoin is stable enough to undergo various sequencing procedures such as those which involve chromatography and mass spectrometry. This was an improvement on an earlier method proposed by Abderhalden and Brockmann in 1930 that demonstrated N-terminal amino acid conversion to a hydantoin under stronger hydrolytic conditions, where some cleavage of the residual peptide proved problematic. The primary advantage the Edman degradation has over the Bergmann degradation is the ease with which the residual peptide can re-enter the process due to retention of its structure throughout sequential cleaving. Repetition of the Bergmann degradation is presumably not as straightforward, as the remaining peptide is in amide form.
The human NDUFB4 gene codes for a subunit of Complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. However, NDUFB4 is an accessory subunit of the complex that is believed not to be involved in catalysis. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein complex has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Initially, NADH binds to Complex I and transfers two electrons to the isoalloxazine ring of the flavin mononucleotide (FMN) prosthetic arm to form FMNH2. The electrons are transferred through a series of iron-sulfur (Fe-S) clusters in the prosthetic arm and finally to coenzyme Q10 (CoQ), which is reduced to ubiquinol (CoQH2). The flow of electrons changes the redox state of the protein, resulting in a conformational change and pK shift of the ionizable side chain, which pumps four hydrogen ions out of the mitochondrial matrix.
In organic chemistry, an active ester is an ester functional group that is highly susceptible toward nucleophilic attack. Activation can be imparted by modifications of the acyl or the alkoxy components of a normal ester, say ethyl acetate. Typical modifications call for electronegative substituents. Active esters are employed in both synthetic and biological chemistry. Active esters are mainly used as acylating agents. They undergo the same reactions as their unactivated analogues but do so more rapidly. They are prone to hydrolysis, for example. Of great interest is the enhanced reactivity of active esters toward amines to give amides. Active esters are prominent in biochemistry. Glutamine synthetase is an enzyme that forms an active ester from the terminal carboxylate of glutamic acid. This activation, imparted by phosphorylation, facilitates the conversion of the carboxylate to an amide called glutamine.
Amyloidosis has a combined estimated prevalence of 30 per 100,000 persons with the three most common forms being AL, ATTR, and AA. The median age at diagnosis is 64. AL has the highest incidence at approximately 12 cases per million persons per year and an estimated prevalence of 30,000 to 45,000 cases in the US and European Union. AA amyloidoses is the most common form in developing countries and can complicate longstanding infections with tuberculosis, osteomyelitis, and bronchiectasis. AA amyloidosis is caused by an increase in extracellular deposition of serum amyloid A (SAA) protein. SAA protein levels can rise in both direct and indirect manners, through infection, inflammation, and malignancies. The most common causes of AA amyloidosis in the West are rheumatoid arthritis, inflammatory bowel disease, psoriasis, and familial Mediterranean fever. People undergoing long-term hemodialysis (14–15 years) can develop amyloidosis from accumulation of light chains of the HLA 1 complex which is normally filtered out by the kidneys. Wild-type transthyretin (ATTR) amyloidosis is found in a quarter of elderly at postmortem. ATTR is found in 13–19% of people experiencing heart failure with preserved ejection fraction, making it a very common form of systemic amyloidosis.
The kinetics of labeled derivatives of apamin were studied in vitro and in vivo in mice by Cheng-Raude et al. This shed some light on the kinetics of apamin itself. The key organ for excretion is likely to be the kidney, since enrichment of the labeled derivatives was found there. The peptide apamin is small enough to pass the glomerular barrier, facilitating renal excretion. The central nervous system, contrarily, was found to contain only very small amounts of apamin. This is unexpected, as this is the target organ for neurotoxicity caused by apamin. This low concentration thus appeared to be sufficient to cause the toxic effects. However, these results disagree with a study of Vincent et al. After injection of a supralethal dose of radioactive acetylated apamin in mice, enrichment was found in the spinal cord, which is part of the target organ. Some other organs, including kidney and brain, contained only small amounts of the apamin derivative. Symptoms following bee sting may include:
Sources: en.wikipedia.org
The molecular weight of c7orf26 is 50 kilodaltons. The isoelectric point is 7.61. The protein sequence is uniquely rich for leucine at 15.8% of its composition, this may indicate a leucine-zipper. Further analysis from PSORT indicates that a leucine-zipper region is found at amino acid 318 and lasts until position 340 (22 amino acids long). There are no extremes with regards to acidity and alkalinity. c7orf26 has a positive charge cluster from amino acid 245 – 275 and does not have any negative, or mixed charge clusters. An even distribution of amino acids compose c7orf26. The percent composition of each amino acid is fairly consistent throughout the orthologs of the protein. The most distant ortholog displays the most variance in amino acid composition. There is a higher percent composition of tyrosine, histidine and leucine and a lower composition of valine and alanine.
Absolute bioavailability compares the bioavailability of the active drug in systemic circulation following non-intravenous administration (i.e., after oral, buccal, ocular, nasal, rectal, transdermal, subcutaneous, or sublingual administration), with the bioavailability of the same drug following intravenous administration. It is the fraction of exposure to a drug (AUC) through non-intravenous administration compared with the corresponding intravenous administration of the same drug. The comparison must be dose normalized (e.g., account for different doses or varying weights of the subjects); consequently, the amount absorbed is corrected by dividing the corresponding dose administered. In pharmacology, in order to determine absolute bioavailability of a drug, a pharmacokinetic study must be done to obtain a plasma drug concentration vs time plot for the drug after both intravenous (iv) and extravascular (non-intravenous, i.e., oral) administration. The absolute bioavailability is the dose-corrected area under curve (AUC) non-intravenous divided by AUC intravenous. The formula for calculating the absolute bioavailability, F, of a drug administered orally (po) is given below (where D is dose administered).
The phenolic ring that is indispensable for binding to estrogen receptor The ring of isoflavones mimicking a ring of estrogens at the receptors binding site Low molecular weight similar to estrogens (MW=272) Distance between two hydroxyl groups at the isoflavones nucleus similar to that occurring in estradiol Optimal hydroxylation pattern In addition to interaction with ERs, phytoestrogens may also modulate the concentration of endogenous estrogens by binding or inactivating some enzymes, and may affect the bioavailability of sex hormones by depressing or stimulating the synthesis of sex hormone-binding globulin (SHBG). Emerging evidence shows that some phytoestrogens bind to and transactivate peroxisome proliferator-activated receptors (PPARs). In vitro studies show an activation of PPARs at concentrations above 1 μM, which is higher than the activation level of ERs. At the concentration below 1 μM, activation of ERs may play a dominant role. At higher concentrations (>1 μM), both ERs and PPARs are activated. Studies have shown that both ERs and PPARs influence each other and therefore induce differential effects in a dose-dependent way. The final biological effects of genistein are determined by the balance among these pleiotrophic actions.
The first generation uses linking technologies that conjugate drugs non-selectively to cysteine or lysine residues in the antibody, resulting in a heterogeneous mixture. This approach leads to suboptimal safety and efficacy and complicates optimization of the biological, physical and pharmacological properties. Site-specific incorporation of unnatural amino acids generates a site for controlled and stable attachment. This enables the production of homogeneous ADCs with the antibody precisely linked to the drug and controlled ratios of antibody to drug, allowing the selection of a best-in-class ADC. An Escherichia coli-based open cell-free synthesis (OCFS) allows the synthesis of proteins containing site-specifically incorporated non-natural amino acids and has been optimized for predictable high-yield protein synthesis and folding. The absence of a cell wall allows the addition of non-natural factors to the system to manipulate transcription, translation and folding to provide precise protein expression modulation.
Messenger RNA (mRNA) carries information about a protein sequence to the ribosomes, the protein synthesis factories in the cell. It is coded so that every three nucleotides (a codon) corresponds to one amino acid. In eukaryotic cells, once precursor mRNA (pre-mRNA) has been transcribed from DNA, it is processed to mature mRNA. This removes its introns—non-coding sections of the pre-mRNA. The mRNA is then exported from the nucleus to the cytoplasm, where it is bound to ribosomes and translated into its corresponding protein form with the help of tRNA. In prokaryotic cells, which do not have nucleus and cytoplasm compartments, mRNA can bind to ribosomes while it is being transcribed from DNA. After a certain amount of time, the message degrades into its component nucleotides with the assistance of ribonucleases. Transfer RNA (tRNA) is a small RNA chain of about 80 nucleotides that transfers a specific amino acid to a growing polypeptide chain at the ribosomal site of protein synthesis during translation. It has sites for amino acid attachment and an anticodon region for codon recognition that binds to a specific sequence on the messenger RNA chain through hydrogen bonding.
Sources: en.wikipedia.org
No, it is a synthetic peptide fragment corresponding to a small portion of hGH. It is not the full 191-amino-acid hormone and does not reproduce all of hGH's effects.
It is commonly described as a 16-amino-acid peptide based on residues 176-191 of human growth hormone. Some sources vary in notation, so checking the stated sequence is useful.
It is not typically described as a standalone natural hormone. The sequence is derived from the C-terminal region of human growth hormone, but the synthetic peptide is a laboratory-made construct.
Yes, the World Anti-Doping Agency classifies AOD-9604 as a prohibited peptide hormone and related substance. Its use by athletes is banned under the relevant anti-doping code.