This is a working overview of anti-doping analysis, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-06-29 and is reviewed periodically as new material appears.
AOD-9604 is a synthetic peptide whose structure corresponds to a C-terminal segment of human growth hormone. It is often described as hGH fragment 176-191, a 16-amino-acid sequence. The peptide was designed to isolate a region of hGH associated with fat metabolism while avoiding the full hormone's growth-promoting actions. Laboratory and commercial materials typically present it as a lyophilized powder for research use. Its identity is defined by amino acid sequence, not by a single brand.
The fragment includes residues that can form an internal disulfide bond between two cysteine positions. This structural feature can influence how the peptide folds and how stable it is in solution. AOD-9604 differs from full-length hGH in size and receptor interactions; it does not contain the entire growth hormone sequence. Published descriptions sometimes use slightly different residue numbering, so sequence information should be checked against primary sources. The molecule is small compared with intact hGH, which affects analytical detection and purification approaches.
Interest in AOD-9604 arose from attempts to separate metabolic effects from growth effects attributed to hGH. Early work explored whether the fragment could influence lipolysis or fat oxidation without promoting growth. Those questions remain partly unresolved because human data are limited and results have varied across studies. The peptide is not a hormone replacement for hGH and is not equivalent to hGH in clinical use. Its research history includes both laboratory studies and commercial marketing claims that are not the same as regulatory approval.
Detection of AOD-9604 in biological samples relies on analytical techniques capable of distinguishing a small synthetic peptide from related endogenous sequences. Liquid chromatography coupled with tandem mass spectrometry is commonly used for confirmatory analysis. Sample preparation may involve immunoaffinity enrichment or solid-phase extraction to concentrate the peptide. Because the molecule is small and may be present at low concentrations, assay sensitivity and specificity are ongoing analytical challenges. Laboratories also validate methods against reference materials when available.
Regulatory interest in AOD-9604 increased after high-profile anti-doping cases involving peptide products. In some cases, the substance was supplied under alternative names or in compounded preparations, complicating traceability. Sports tribunals and anti-doping panels have discussed whether the peptide was explicitly banned at the time of use, leading to clarifications by the World Anti-Doping Agency. For consumers and researchers, the legal status can vary by jurisdiction, and products marketed as research chemicals may lack independent quality verification.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Based on the C-terminal region of human growth hormone. |
| Amino acid length | 16 residues | Often described as hGH fragment 176-191. |
| Appearance | Lyophilized powder | Typically white to off-white; exact appearance depends on grade. |
| Solubility | Soluble in water | Aqueous solubility depends on pH, ionic strength, and preparation. |
| Typical storage | -20 °C or lower | Lyophilized peptide is usually kept cold and dry; solutions may require freezing. |
Regulatory treatment of AOD-9604 is shaped by its classification as a peptide hormone. The World Anti-Doping Agency lists it as a prohibited substance, and many national anti-doping organizations adopt that list. It does not hold approval as a prescription medicine in the United States, the European Union, or other major markets. Products sold online are frequently labeled for research use only and may not undergo independent quality testing. Import and possession rules differ by country, so legal status depends on local law.
Proposed mechanisms for AOD-9604 focus on fat cells. Laboratory studies suggest the peptide can increase lipolysis, the breakdown of stored fat, and reduce lipogenesis, the formation of new fat. Unlike full human growth hormone, it does not appear to stimulate substantial IGF-1 production in the studies reported so far. Some evidence points to beta-adrenergic signaling, but the precise receptor targets and downstream pathways remain unresolved. The fragment is not thought to act through the classical growth hormone receptor.
Clinical development of AOD-9604 included trials in people with obesity. Reports from early-phase and mid-phase studies described modest or inconsistent changes in body weight. A phase IIb program did not meet its primary endpoint, and the compound was not approved for medical use. Differences in formulation, delivery route, and participant characteristics may explain some of the variation. Later investigations explored whether the peptide might have effects in other tissues, including cartilage.
Identity and purity are commonly checked with reversed-phase high-performance liquid chromatography and mass spectrometry. RP-HPLC separates the peptide from related impurities and can estimate purity by peak area. Mass spectrometry confirms molecular mass and helps detect sequence variants or truncations. Some laboratories use amino acid analysis or peptide mapping for additional characterization. No single method proves biological activity; these techniques establish chemical identity and purity only. They also require suitable reference standards for confident comparison.
Commercial AOD-9604 may vary in purity, counterion content, and residual moisture. Certificates of analysis often report HPLC purity, mass confirmation, and appearance, but testing methods differ between suppliers. Independent verification is sometimes used because labeled content may not match actual peptide amount. Stability under different pH and temperature conditions is not fully standardized across studies. Researchers generally treat lyophilized material as the reference form for weighing and reconstitution. Moisture content can affect accurate mass measurement.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
AOD-9604 has been investigated primarily as a potential treatment for obesity and related metabolic conditions. Early laboratory work examined its effects on fat cells, and later studies moved into animal models and human clinical trials. Some trials reportedly reached Phase II, but the program did not lead to an approved medicine. Published summaries often note that weight-loss results were modest or inconsistent. The full trial data are not all publicly available in detail.
This leads to a reduction in the newly synthesized pool of dopamine from replenished tyrosine. AMPT’s effect on dopamine concentration and transport is reversible and short-lived. If methamphetamine is administered while cytoplasmic dopamine is depleted to about 50% of the control levels, its neurotoxic effects are averted (Thomas et al., 2008). The recovery of dopamine to normal levels after AMPT administration takes about 2 to 7 days, and this repletion of dopamine is not changed by methamphetamine. For these reasons AMPT seems to be a better treatment drug in methamphetamine addicts than reserpine, which is also being researched as a possible methamphetamine treatment drug. Reserpine causes almost full loss of dopamine from the striatum by disrupting vesicle storage. The repletion of dopamine after reserpine administration is slower than AMPT. Additionally, administration of reserpine when dopamine is maximally depleted causes neurotoxic effects, which does not occur with AMPT treatment. AMPT’s role in addiction has also been studied via changes in dopamine binding to D2 and D3 receptors in the striatum (caudate, putamen, and ventral striatum) after the administration of AMPT. Findings revealed that cocaine-dependent subjects exhibited lower levels of endogenous dopamine relative to healthy subjects after AMPT administration. Similar positive effects were found in the role of AMPT in methamphetamine-addicted subjects. Dystonias and dyskinesias onset seems to derive from inconsistent regulation of dopamine in dopamine pathways.
"Current map of sea surface temperature anomalies in the Pacific Ocean". earth.nullschool.net. "Southern Oscillation diagnostic discussion". Climate Prediction Center. National Oceanic and Atmospheric Administration. "ENSO Outlook – An alert system for the El Niño–Southern Oscillation". Australian Bureau of Meteorology. Provides current phase of ENSO according to the Australian interpretation. "Cold & Warm Episodes by Season / Relative Oceanic Niño Index (RONI): Historical El Niño / La Niña episodes (1950–Present)". National Oceanic and Atmospheric Administration (NOAA).
== Artificial de-excitation == 180mTa can be forced to release its energy by X-rays. This was predicted theoretically in 1988 by C. B. Collins, although at that time this de-excitation mechanism had never been observed. This was observed in 180mTa by resonant photo-excitation of intermediate high levels of this nucleus (E ≈ 1 MeV), in 1999 by Belic and co-workers in the Stuttgart nuclear physics group. 178m272Hf is another reasonably stable nuclear isomer, with a half-life of 31 years and a remarkably high excitation energy for that life. In its natural decay, 2.45 MeV is released as gamma rays. As with 180mTa, it is thought that 178m2Hf can be stimulated into releasing its energy. Due to this, the substance has been studied as a possible source for gamma-ray lasers, and reports have indicated that the energy could be released very quickly, so that 178m2Hf can produce extremely high powers (on the order of exawatts). It was supposedly detected experimentally in the 2000s, but it was controversial and not independently confirmed. Other isomers have also been investigated as possible media for gamma-ray stimulated emission.
=== Films === Very Important Person (film), a 1961 British film The V.I.P.s (film), a 1963 film VIP my Brother Superman, a 1968 Italian animation film V.I.P. (1991 film), a Polish film by Juliusz Machulski V. I. P. (1997 film), an Indian Tamil film VIPs (film), a 2010 Brazilian film Velaiilla Pattadhari, a 2014 film also known as VIP V.I.P. (2017 film), a South Korean film
Sources: en.wikipedia.org
In animal and Human biology, a tendon cell is a cell that makes up tendons, the bands of connective tissue that connects muscles to bones. Tendon cells, also known as tenocytes or tendon fibroblasts, are specialized cells that contribute to the structure, function, and repair of tendons in the body. Tendons are fibrous tissues that connect muscles to bones, and tendon cells play a vital role in maintaining tendon homeostasis and facilitating healing following injury.
== Chemistry == Grammotoxin is a 36 amino acid protein toxin, with the sequence Asp-Cys-Val-Arg-Phe-Trp-Gly-Lys-Cys-Ser-Gln-Thr-Ser-Asp-Cys-Cys-Pro-His-Leu-Ala-Cys-Lys-Ser-Lys-Trp-Pro-Arg-Asn-Ile-Cys-Val-Trp-Asp-Gly-Ser-Val (DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV), and disulfide bridges between Cys2-Cys16, Cys9-Cys21 and Cys15-Cys30. It forms an inhibitor cystine knot motif, common in spider toxins. Its chemical formula is: C177H268N52O50S6 Grammotoxin can be purified from Grammostola spatulata venom by reverse phase high performance liquid chromatography.
(1886), lawyer and stockbroker, grandfather of Jacqueline Kennedy Onassis, Lee Radziwill and Edith Bouvier Beale Benjamin Cardozo (1889), associate justice of the U.S. Supreme Court William Bondy (1890), judge on the United States District Court for the Southern District of New York Irving Lehman (1896), chief judge of the New York Court of Appeals, son of Mayer Lehman and member of the Lehman family Joseph M. Proskauer (1896), lawyer, judge, co-founder of international law firm Proskauer Rose Frederic Kimber Seward (1899), corporate lawyer and Titanic survivor Arthur Garfield Hays (1902), counsel for the American Civil Liberties Union and lawyer in the Scopes Trial Benjamin Kaye (1904), lawyer, playwright, co-founder of international law firm Kaye Scholer George Z. Medalie (1905), United States Attorney for the Southern District of New York 1931–1933; Republican nominee for the United States Senate in New York in 1932 Irwin Untermyer (1907), jurist, civic leader, son of Samuel Untermyer Alexander Holtzoff (1908), judge on the United States District Court for the District of Columbia Paul Windels (1908), former Corporation Counsel of New York City and co-founder of the Lycée Français de New York Emil N. Baar (1913), New York Supreme Court justice and former chairman of the Union of American Hebrew Congregations Albert Levitt (1913), judge on the District Court of the Virgin Islands Peter I. B. Lavan (1915), lawyer and philanthropist and namesake of Stroock & Stroock & Lavan Raymond L.
Legal age (18+ years) High school diploma or equivalent State-approved training Successful completion of certification exam Medical laboratory assistants are required to have good analytical abilities and keen attention to detail. They must be able to work under pressure and display manual dexterity. Because they work with minute substances and technical equipment, good vision and computer skills are mandatory.
=== 1995–2006: DNA identity testing === In 1995, Bio-Synthesis, Inc. introduced DNA identity testing to its broad range of molecular diagnostic services. Today, the DNA Identity Testing Center of BSI uses advanced techniques and automated systems to produce the most accurate DNA testing results allowed by current scientific technologies. The DNA Identity Testing Center has its own staff of scientific professionals whose focus is to ensure the quality and integrity of all tests and services. In 2000, Bio-Synthesis, Inc. perform the genetic analysis close to 500 Chinese nationals that were soliciting, under the right of abode, the right to move to Hong Kong by proving that their biological fathers were Hong Kong residents.
Sources: en.wikipedia.org
=== Hydrogel-forming microneedles === The primary material for the fabrication of hydrogel-forming microneedles (HFMs) is hydrophilic polymer that encloses drugs. This material draws water from interstitial fluid in the stratum corneum and results in polymer swelling and release of drug. Besides, the hydrophilic features of HFMs allow readily uptake of interstitial fluid that could be used for disease diagnosis.
The Israelites, also known as the Children of Israel, were an ancient Semitic-speaking people who lived in Canaan during the Iron Age. They are associated with Hebrews and spoke Biblical Hebrew, an archaic Hebrew language. In the biblical myth, the Israelites were divided into the Twelve Tribes of Israel and later formed the Iron Age kingdoms of Israel and Judah. Modern scholarship describes the Israelites as emerging from indigenous Canaanite populations and other peoples of the ancient Near East. The Israelite religion revolved around Yahweh, who was an ancient Semitic god with less significance in the broader Canaanite religion. Around 720 BCE, the Kingdom of Israel was conquered by the Neo-Assyrian Empire, triggering the Assyrian captivity; and around 586 BCE, the Kingdom of Judah was conquered by the Neo-Babylonian Empire, triggering the Babylonian captivity. While most of Israel's population was irreversibly dispossessed as a result of Assyrian resettlement policy, the exiled Judahites were allowed to return and rehabilitate their country by the Achaemenid king Cyrus the Great following the fall of Babylon in 539 BCE. In the narrative of the Hebrew Bible, the Israelites were the descendants of Jacob (later known as Israel), who was a son of Isaac and thereby a grandson of Abraham. Due to a severe drought in Canaan, Jacob and his twelve sons migrated to Egypt, where each son became the eponymous progenitor of an Israelite tribe.
Zortac is voiced by Yasuhiko Kawazu (川津 泰彦, Kawazu Yasuhiko). Thousanian Gineka (サウザン星人ギネーカ, Sauzan Seijin Ginēka): A profligate from Planet Thousan who murdered countless innocents via his Kaijuki Million Missile (ミリオンミサイル, Mirion Misairu), which is capable of transforming into a stealth aircraft, in a specialized game he and his friends set up with a rare jewel as a marker. Gineka is deleted by the Deka Wing Cannon. Gineka is voiced by Kappei Yamaguchi (山口 勝平, Yamaguchi Kappei). Handorean Decho (ハンドレ星人デーチョ, Handore Seijin Dēcho) and Tentean Siroger (テンテ星人シロガー, Tente Seijin Shirogā): Gineka's accomplices from Planets Handore and Tente, respectively, who join him in his game after rebuilding Durden's and Dazgonelr's respective Kaijuki, Ultimate Evil and Embarns, before they are deleted by Deka Wing Robo. Decho and Siroger are voiced by Akimitsu Takase (高瀬 右光, Takase Akimitsu) and Junji Kitajima (北島 淳司, Kitajima Junji) respectively. Tenkaonian Raja Namunan (テンカオ星人ラジャ・ナムナン, Tenkao Seijin Raja Namunan): A seahorse-themed criminal from Planet Tenkao who is charged with 103 counts of burglary and who murdered Detective Chou San's daughter 13 years prior to the series, though the murder could not originally be connected to him. After he is successfully charged with the murder in the present, Namunan attempts to escape justice in his Kaijuki, Knight Chaser 2 (ナイトチェイサー2, Naito Cheisā Tsū), only to be deleted by the Deka Wing Cannon. Raja Namunan is voiced by Ryōichi Tanaka (田中 亮一, Tanaka Ryōichi).
=== Feminism === The growth of popularity and access to TikTok has contributed to a growth in popularity of digital feminist movements and discourse originating from the platform. Digital spaces like TikTok enable marginalized communities and activists, such as feminists, to feel safer and have an easier place to engage in discussion and dialogue or build an identity which might otherwise be impossible due to circumstances. The momentum of digital feminist movements through platforms like TikTok have additionally encouraged many social media agents and marketing campaigns around the world to adopt some degree of feminism as a part of their online image or personal brand. TikTok's unique platform organization, of spontaneous peer-peer information sharing, has enabled its utilization for community-engaged, digital knowledge mobilization and exchange between social justice communities. However inversely enabled by the platform's organic potential, both feminist challenges and anti-feminist reinforcement of dominant social, hierarchical, and gender values are widespread and instigated through TikTok, and content labeled as anti-feminist is itself popularized on TikTok.
Sources: en.wikipedia.org
It is a synthetic peptide based on a C-terminal fragment of human growth hormone. It is commonly referred to as hGH fragment 176-191 and is studied for metabolic effects rather than growth effects.
No. It represents only a short portion of the hGH sequence and lacks the full hormone's structure. As a result, its biological activity and regulatory status differ from those of prescription hGH.
The exact peptide is not typically described as a circulating hormone; it is a synthetic construct based on a natural sequence. Fragments of hGH can exist in laboratory or metabolic contexts, but AOD-9604 itself is manufactured for research.
Yes, the World Anti-Doping Agency classifies AOD-9604 as a prohibited peptide hormone and related substance. Its use by athletes is banned under the relevant anti-doping code.